PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G302300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 217aa    MW: 22443.2 Da    PI: 8.2293
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G302300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_156.37.1e-18145196354
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                         +++r +r++kNRe+A rsR+RK+a++ eLe++v+ L++eN++L+ + e+l+ 
  Sevir.2G302300.1.p 145 SDRRKKRMIKNRESAARSRARKQAYVRELEREVQLLQQENESLRVKYEQLRV 196
                         689******************************************9999975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-13143210IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.151145195IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-15145198No hitNo description
PfamPF001701.2E-15146197IPR004827Basic-leucine zipper domain
CDDcd147075.25E-23147194No hitNo description
SuperFamilySSF579598.75E-13147196No hitNo description
PROSITE patternPS000360150165IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:2000028Biological Processregulation of photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MAAMDLEDDE DIWGNTASSP SASPTPLTTA VVAPCGAFIS TQLSLNSRLQ LLSTTAAAGG  60
SSPPHSVGAG IFAADGLRHH VGLGDGGGGG FRNAPASPAP FFSAYGLDAG GGVAPIDAGA  120
ARSALEDEMC VGPGTAWAGA GVGGSDRRKK RMIKNRESAA RSRARKQAYV RELEREVQLL  180
QQENESLRVK YEQLRVSVEV PVPVKKTLQR MPSAPF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0937893e-76EF093789.1 Zea mays delayed flowering1 (DLF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957504.11e-155PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLK3ZWU51e-155K3ZWU5_SETIT; Uncharacterized protein
STRINGSi031077m1e-155(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17770.22e-17basic region/leucine zipper motif 27